PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.193460.1
Common NameCsa_5G148470, LOC101206531
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family NAC
Protein Properties Length: 398aa    MW: 45842.9 Da    PI: 6.7755
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.193460.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1661.3e-51111391128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPt+eel+++yL+kkv+ +k++l +vi++vd++k+ePwd+++k+k     +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk +
  Cucsa.193460.1  11 VPPGFRFHPTEEELLHYYLRKKVAFQKIDL-DVIRDVDLNKLEPWDIQEKCKIgstPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKII 104
                     69****************************.9***************964444222455************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++ +++ +gl+ktLvfykgrap+g+k+dW+mheyrl
  Cucsa.193460.1 105 YT-GSKRIGLRKTLVFYKGRAPHGQKSDWIMHEYRL 139
                     *9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-577170IPR003441NAC domain
PROSITE profilePS5100556.90211170IPR003441NAC domain
PfamPF023655.1E-2712139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MTLSVNGHSQ VPPGFRFHPT EEELLHYYLR KKVAFQKIDL DVIRDVDLNK LEPWDIQEKC  60
KIGSTPQNDW YFFSHKDKKY PTGTRTNRAT AAGFWKATGR DKIIYTGSKR IGLRKTLVFY  120
KGRAPHGQKS DWIMHEYRLD DSDRDINICN SIGESQLAED GWVVCRVFKK KNYQKSIDSP  180
KTSPTSMDSE VHLLNSNNDG VLDQILQYMG RTCKLEMESF SNNINNNSNS SSRLILSPNN  240
NNTEDHQQQT IDKSFMHLPR LDSPTTIPSI ISLHQLETSS PFDHNIIFNH EMLSVSETTT  300
EPSPRPVVKL DNWVAFDRLV ASQLNGQDER SVMEDDEDEQ QQQQQQHHHH HHHEQQHHHH  360
HMQVSNRVLG YGHENDIWGF TKSSSSSSLD PLSHLSV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A5e-501117220170NAC domain-containing protein 19
3swm_B5e-501117220170NAC domain-containing protein 19
3swm_C5e-501117220170NAC domain-containing protein 19
3swm_D5e-501117220170NAC domain-containing protein 19
3swp_A5e-501117220170NAC domain-containing protein 19
3swp_B5e-501117220170NAC domain-containing protein 19
3swp_C5e-501117220170NAC domain-containing protein 19
3swp_D5e-501117220170NAC domain-containing protein 19
3ulx_A5e-501117215170Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00016PBMTransfer from AT1G32770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818950.0LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005.
GenBankLN7132630.0LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004143941.10.0PREDICTED: NAC domain-containing protein 12
SwissprotQ9LPI71e-116NAC12_ARATH; NAC domain-containing protein 12
TrEMBLA0A0A0KQL00.0A0A0A0KQL0_CUCSA; Uncharacterized protein
STRINGVIT_02s0025g02710.t011e-158(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-105NAC family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]